Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep TNF protein

This Sheep TNF protein spans the amino acid sequence from region 78-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin, TNF-alphaTumor necrosis factor ligand superfamily member 2 , TNF-a

UniProt

P23383

Expression Region

78-234aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kif21b Mouse shRNA Plasmid (Locus ID 16565)
TL501181 1 Kit

Kif21b Mouse shRNA Plasmid (Locus ID 16565)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)
MBS2137630-01 0.1 mL

APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)
MBS2137630-02 0.2 mL

APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)
MBS2137630-03 0.5 mL

APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)
MBS2137630-04 1 mL

APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)
MBS2137630-05 5 mL

APC_Cy7 Linked Monoclonal Antibody to Calponin 2 (CNN2)

Sign In for Pricing
View Details