Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep TNF protein

This Sheep TNF protein spans the amino acid sequence from region 78-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin, TNF-alphaTumor necrosis factor ligand superfamily member 2 , TNF-a

UniProt

P23383

Expression Region

78-234aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDGA2 Rabbit Polyclonal Antibody
BT-AP11278-01 20 µL

MDGA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MDGA2 Rabbit Polyclonal Antibody
BT-AP11278-02 50 µL

MDGA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MDGA2 Rabbit Polyclonal Antibody
BT-AP11278-03 100 µL

MDGA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MLEC Protein Vector (Mouse) (pPM-C-HA)
30186024 500 ng

MLEC Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
HSPA2 Rabbit mAb (AMR12239N)
AMR12239N-01 50 µL

HSPA2 Rabbit mAb (AMR12239N)

Sign In for Pricing
View Details
HSPA2 Rabbit mAb (AMR12239N)
AMR12239N-02 100 µL

HSPA2 Rabbit mAb (AMR12239N)

Sign In for Pricing
View Details