Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PSAP protein

This Mouse PSAP protein spans the amino acid sequence from region 1-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Co-beta-glucosidaseGlucosylceramidase activatorSphingolipid activator protein 2 , SAP-2

UniProt

P20097

Expression Region

1-81aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Cavia porcellus (Guinea pig)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Congo Red Indicator Papers
00846 010BK 10 Books

Congo Red Indicator Papers

Sign In for Pricing
View Details
TIGIT Protein, Human, Recombinant (ECD, His Tag)
MBS8120579-01 0.05 mg

TIGIT Protein, Human, Recombinant (ECD, His Tag)

Sign In for Pricing
View Details
TIGIT Protein, Human, Recombinant (ECD, His Tag)
MBS8120579-02 0.5 mg

TIGIT Protein, Human, Recombinant (ECD, His Tag)

Sign In for Pricing
View Details
TIGIT Protein, Human, Recombinant (ECD, His Tag)
MBS8120579-03 5x 0.5 mg

TIGIT Protein, Human, Recombinant (ECD, His Tag)

Sign In for Pricing
View Details
SUZ12 (Suppressor of Zeste 12 Protein Homolog, CHET9, JJAZF1, KIAA0160, LOC23512) (MaxLight 405)
MBS6245102-01 0.1 mL

SUZ12 (Suppressor of Zeste 12 Protein Homolog, CHET9, JJAZF1, KIAA0160, LOC23512) (MaxLight 405)

Sign In for Pricing
View Details
SUZ12 (Suppressor of Zeste 12 Protein Homolog, CHET9, JJAZF1, KIAA0160, LOC23512) (MaxLight 405)
MBS6245102-02 5x 0.1 mL

SUZ12 (Suppressor of Zeste 12 Protein Homolog, CHET9, JJAZF1, KIAA0160, LOC23512) (MaxLight 405)

Sign In for Pricing
View Details