Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PSAP protein

This Mouse PSAP protein spans the amino acid sequence from region 1-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Co-beta-glucosidaseGlucosylceramidase activatorSphingolipid activator protein 2 , SAP-2

UniProt

P20097

Expression Region

1-81aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Cavia porcellus (Guinea pig)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Chk2 (Ser19) Antibody
AF8023-01 100 µL

Phospho-Chk2 (Ser19) Antibody

Sign In for Pricing
View Details
Phospho-Chk2 (Ser19) Antibody
AF8023-02 200 µL

Phospho-Chk2 (Ser19) Antibody

Sign In for Pricing
View Details
TF (Tissue Factor) BioAssayTM ELISA Kit (Mouse) discontinued
384579 96 Tests

TF (Tissue Factor) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
FAIM3 Rabbit Polyclonal Antibody (PE-Cy7)
orb887597 100 µL

FAIM3 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Suppressor Of Variegation 4-20 Homolog 2 (Biotin)
550078 200 µL

Suppressor Of Variegation 4-20 Homolog 2 (Biotin)

Sign In for Pricing
View Details
CCL16/LEC Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2439272 100 µL

CCL16/LEC Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details