Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PSAP protein

This Mouse PSAP protein spans the amino acid sequence from region 1-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Co-beta-glucosidaseGlucosylceramidase activatorSphingolipid activator protein 2 , SAP-2

UniProt

P20097

Expression Region

1-81aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Cavia porcellus (Guinea pig)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WYE 354
MBS132176-01 100 mg

WYE 354

Sign In for Pricing
View Details
WYE 354
MBS132176-02 500 mg

WYE 354

Sign In for Pricing
View Details
Anti-HGFAC Antibody Picoband® HRP Conjugated
A09351-2-HRP 100 µg/Vial

Anti-HGFAC Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
THUMPD3 CRISPR Activation Plasmid (h)
sc-411832-ACT 20 µg

THUMPD3 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Mouse Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit
RD-SLC30A3-Mu-48Tests 48 Tests

Mouse Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit

Sign In for Pricing
View Details
Akt (Thr-34), Phosphospecific Antibody
bs-70331R 100 µL

Akt (Thr-34), Phosphospecific Antibody

Sign In for Pricing
View Details