Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PI3 protein

This Human PI3 protein spans the amino acid sequence from region 61-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Elastase-specific inhibitor , ESIPeptidase inhibitor 3 , PI-3, Protease inhibitor WAP3Skin-derived antileukoproteinase , SKALPWAP four-disulfide core domain protein 14

UniProt

P19957

Expression Region

61-117aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTBP1 Antibody
orb1258434 100 µL

PTBP1 Antibody

Sign In for Pricing
View Details
ANKMY2 Antibody
orb1320259-01 30 µL

ANKMY2 Antibody

Sign In for Pricing
View Details
ANKMY2 Antibody
orb1320259-02 50 μL

ANKMY2 Antibody

Sign In for Pricing
View Details
ANKMY2 Antibody
orb1320259-03 100 µL

ANKMY2 Antibody

Sign In for Pricing
View Details
NR2F2 Antibody
orb1242392 100 µL

NR2F2 Antibody

Sign In for Pricing
View Details
Anti-PGP9.5 Polyclonal Antibody
TMAB-10251-01 50 μL

Anti-PGP9.5 Polyclonal Antibody

Sign In for Pricing
View Details