Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PI3 protein

This Human PI3 protein spans the amino acid sequence from region 61-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Elastase-specific inhibitor , ESIPeptidase inhibitor 3 , PI-3, Protease inhibitor WAP3Skin-derived antileukoproteinase , SKALPWAP four-disulfide core domain protein 14

UniProt

P19957

Expression Region

61-117aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anticancer agent 95
T83074-01 5 mg

Anticancer agent 95

Sign In for Pricing
View Details
Anticancer agent 95
T83074-02 50 mg

Anticancer agent 95

Sign In for Pricing
View Details
Myotubularin-Related protein 9 (MTMR9) Mouse ELISA Kit
F2131 96 Tests

Myotubularin-Related protein 9 (MTMR9) Mouse ELISA Kit

Sign In for Pricing
View Details
Recombinant Human TAFA4 protein
MBS1562773-01 0.05 mg

Recombinant Human TAFA4 protein

Sign In for Pricing
View Details
Recombinant Human TAFA4 protein
MBS1562773-02 0.1 mg

Recombinant Human TAFA4 protein

Sign In for Pricing
View Details
Recombinant Human TAFA4 protein
MBS1562773-03 5x 0.1 mg

Recombinant Human TAFA4 protein

Sign In for Pricing
View Details