Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HNRNPL protein

This Human HNRNPL protein spans the amino acid sequence from region 89-335aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6NTA2

Expression Region

89-335aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf63 Antibody
orb1331148 100 µg

C10orf63 Antibody

Sign In for Pricing
View Details
DAZAP1 Antibody, HRP conjugated
CSB-PA822205LB01HU-01 50 µg

DAZAP1 Antibody, HRP conjugated

Sign In for Pricing
View Details
DAZAP1 Antibody, HRP conjugated
CSB-PA822205LB01HU-02 100 µg

DAZAP1 Antibody, HRP conjugated

Sign In for Pricing
View Details
ENSA (Endosulfine alpha, OTTHUMP00000032931, OTTHUMP00000032932, OTTHUMP00000034001, OTTHUMP00000034003, OTTHUMP00000034004, OTTHUMP00000034005, OTTHUMP00000034006, MGC4319, MGC78563, MGC8394) (MaxLight 405) discontinued
207590-ML405 100 µL

ENSA (Endosulfine alpha, OTTHUMP00000032931, OTTHUMP00000032932, OTTHUMP00000034001, OTTHUMP00000034003, OTTHUMP00000034004, OTTHUMP00000034005, OTTHUMP00000034006, MGC4319, MGC78563, MGC8394) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human ZHX1 Pre-designed siRNA Set A
SI018585A 1 Each

Human ZHX1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
2,4-Dibromopyridine
420101-01 100 mg

2,4-Dibromopyridine

Sign In for Pricing
View Details