Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BCL2L11 protein

This Human BCL2L11 protein spans the amino acid sequence from region 1-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl2-interacting mediator of cell death

UniProt

O43521

Expression Region

1-198aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP10 Blocking peptide
orb1443336 500 µg

DUSP10 Blocking peptide

Sign In for Pricing
View Details
TNFR1 Rabbit Polyclonal Antibody
orb100329-01 50 μL

TNFR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFR1 Rabbit Polyclonal Antibody
orb100329-02 100 µL

TNFR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFR1 Rabbit Polyclonal Antibody
orb100329-03 200 µL

TNFR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 4,6-dichloro-1h-indole-2-carboxylate
449315-01 100 mg

Ethyl 4,6-dichloro-1h-indole-2-carboxylate

Sign In for Pricing
View Details
Ethyl 4,6-dichloro-1h-indole-2-carboxylate
449315-02 250 mg

Ethyl 4,6-dichloro-1h-indole-2-carboxylate

Sign In for Pricing
View Details