Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Wisp2 protein

This Mouse Wisp2 protein spans the amino acid sequence from region 24-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCN family member 5Connective tissue growth factor-like protein , CTGF-L

UniProt

Q9Z0G4

Expression Region

24-251aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ccdc141 shRNA (UAS) - Lentiviral mouse Ccdc141 shRNA (UAS) (25)
GTR15145325 1 Vial

Lentiviral mouse Ccdc141 shRNA (UAS) - Lentiviral mouse Ccdc141 shRNA (UAS) (25)

Sign In for Pricing
View Details
Lentiviral mouse Cpeb2 shRNA (UAS) - Lentiviral mouse Cpeb2 shRNA (UAS, RFP) (100)
GTR15179340 1 Vial

Lentiviral mouse Cpeb2 shRNA (UAS) - Lentiviral mouse Cpeb2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral human AHNAK shRNA (UAS) - Lentiviral human AHNAK shRNA (UAS, iRFP) (100)
GTR15160119 1 Vial

Lentiviral human AHNAK shRNA (UAS) - Lentiviral human AHNAK shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
KIR2DL1 antibody
10R-1033 100 µL

KIR2DL1 antibody

Sign In for Pricing
View Details
LT-C4 (Leukotriene C4) Mouse ELISA Kit
E7500 96 Tests

LT-C4 (Leukotriene C4) Mouse ELISA Kit

Sign In for Pricing
View Details
NCoR1 Rabbit pAb, Pacific Blue conjugated
orb2891274 100 µL

NCoR1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details