Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Wisp2 protein

This Mouse Wisp2 protein spans the amino acid sequence from region 24-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCN family member 5Connective tissue growth factor-like protein , CTGF-L

UniProt

Q9Z0G4

Expression Region

24-251aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GINM1 Knockout NCI-H1975 Polyclonal Cells
ARG17328 1 Million

GINM1 Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
Human SSNA1 Knockout HEK293T cell line
GTR15419359 1 Vial

Human SSNA1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Anti-IDNK Antibody Picoband®, APC Conjugate
A15308-2-APC 100 µg/Vial

Anti-IDNK Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
AY761185 Protein Vector (Mouse) (pPB-N-His)
PV157875 500 ng

AY761185 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral human HOXD4 shRNA (UAS) - Lentiviral human HOXD4 shRNA (UAS, iRFP) (25)
GTR15119918 1 Vial

Lentiviral human HOXD4 shRNA (UAS) - Lentiviral human HOXD4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
FLJ35767 Protein Vector (Human) (pPB-C-His)
PV052233 500 ng

FLJ35767 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details