Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Peroxisome proliferator-activated receptor gamma (pparg)

Product Specifications

Product Name Alternative

(PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)

Abbreviation

Recombinant Xenopus laevis pparg protein

Gene Name

Pparg

UniProt

P37234

Expression Region

1-477aa

Organism

Xenopus laevis (African clawed frog)

Target Sequence

MVDTEMPFWSNLNFGMNSMDMSALEDHCQPYDIKPFTTVDFSSINSHYDDILDEKTFLCRNDQSPIDYKYDLKLQECQSSIKLEPPSPPYFSDKPQCSKAFEDTPNSFIAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYERCDLNCRIHKKSRNKCQFCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADQRVLAKHLYDSYVKSFPLTKAKAPGHPDGQSHRQNSRGYTRHELADDGGGSDQGAVREPRAEQGGGDSNLPALSVALRGGVREITEFAKNIPGFVSLDLNDQVTLLKYGVHEIIFTMLASLMNKDGVLVAEGQGFMTREFLKSLRKPFSDFMEPKFEFAIRFNSLELDDSDLAIFVAVIILSGDRPGLLNVKPIEDIQDSLLQALELQLKLNHPDSAQLFAKLLQKMTDLRQVVTEHVQLLQLIKKTEADMCLHPLLQEIYKDLY

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-CoA oxidase and activates its transcription. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. May play a role in the regulation of circadian rhythm .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

58.1 kDa

References & Citations

"Xenopus peroxisome proliferator activated receptors: genomic organization, response element recognition, heterodimer formation with retinoid X receptor and activation by fatty acids." Krey G., Keller H., Mahfoudi A., Medin J., Ozato K., Dreyer C., Wahli W. J. Steroid Biochem. Mol. Biol. 47:65-73 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-100 1x 100 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details