Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human L2HGDH protein

This Human L2HGDH protein spans the amino acid sequence from region 52-463aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Duranin

UniProt

Q9H9P8

Expression Region

52-463aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Coupling Factor 6 (CF6) ELISA Kit
RDR-CF6-Hu-01 96 Tests

Human Coupling Factor 6 (CF6) ELISA Kit

Sign In for Pricing
View Details
Human Coupling Factor 6 (CF6) ELISA Kit
RDR-CF6-Hu-02 48 Tests

Human Coupling Factor 6 (CF6) ELISA Kit

Sign In for Pricing
View Details
HSD3B2 Antibody
orb678845 100 µL

HSD3B2 Antibody

Sign In for Pricing
View Details
CLOCK Rabbit Polyclonal Antibody (BF405)
orb2401368 100 µL

CLOCK Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Rabbit Polyclonal OGFOD1 Antibody [DyLight 550]
NBP1-76532R 0.1 mL

Rabbit Polyclonal OGFOD1 Antibody [DyLight 550]

Sign In for Pricing
View Details
(1S)-trans-Bifenthrin
TRC-B382990-10MG 10 mg

(1S)-trans-Bifenthrin

Sign In for Pricing
View Details