Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SARAF protein

This Human SARAF protein spans the amino acid sequence from region 195-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBV X-transactivated gene 3 proteinHBV XAg-transactivated protein 3, Protein FOAP-7Transmembrane protein 66

UniProt

Q96BY9

Expression Region

195-339aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUSD3 Protein Vector (Rat) (pPB-N-His)
PV309035 500 ng

SUSD3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Cfap418 Mouse siRNA Oligo Duplex (Locus ID 67157)
SR405477 1 Kit

Cfap418 Mouse siRNA Oligo Duplex (Locus ID 67157)

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r180 shRNA (UAS) - Lentiviral mouse Vmn1r180 shRNA (UAS, RFP) plasmid
GTR15218569 1 Vial

Lentiviral mouse Vmn1r180 shRNA (UAS) - Lentiviral mouse Vmn1r180 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
MGST2 (NM_001204367) Human Tagged ORF Clone
RG235498 10 µg

MGST2 (NM_001204367) Human Tagged ORF Clone

Sign In for Pricing
View Details
OR5H4P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV737789 1.0 µg DNA

OR5H4P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rotavirus A (strain Nebraska calf diarrhea virus) VP6 Protein (His)
TMPH-03417-01 5 µg

Rotavirus A (strain Nebraska calf diarrhea virus) VP6 Protein (His)

Sign In for Pricing
View Details