Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SARAF protein

This Human SARAF protein spans the amino acid sequence from region 195-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBV X-transactivated gene 3 proteinHBV XAg-transactivated protein 3, Protein FOAP-7Transmembrane protein 66

UniProt

Q96BY9

Expression Region

195-339aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRRG3 siRNA (h)
sc-91294 10 µM

PRRG3 siRNA (h)

Sign In for Pricing
View Details
RPL31P32 siRNA Oligos set (Human)
41373171 3x 5 nmol

RPL31P32 siRNA Oligos set (Human)

Sign In for Pricing
View Details
EIF3I Antibody (Carrier-free)
orb3156449 100 µg

EIF3I Antibody (Carrier-free)

Sign In for Pricing
View Details
Porcine PEDF ELISA Kit
EPP0091 96 Tests

Porcine PEDF ELISA Kit

Sign In for Pricing
View Details
MRRFP sgRNA CRISPR Lentivector (Human) (Target 3)
K1339304 1.0 µg DNA

MRRFP sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral human KDM6B shRNA (UAS) - Lentiviral human KDM6B shRNA (UAS, GFP) plasmid
GTR15326209 1 Vial

Lentiviral human KDM6B shRNA (UAS) - Lentiviral human KDM6B shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details