Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AADAT protein

This Human AADAT protein spans the amino acid sequence from region 30-425aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-aminoadipate aminotransferase2-aminoadipate transaminase (EC, 2.6.1.39) Alpha-aminoadipate aminotransferase , AadATKynurenine aminotransferase IIKynurenine--oxoglutarate aminotransferase IIKynurenine--oxoglutarate transaminase 2 (EC, 2.6.1.7) Kynurenine--oxoglutarate transaminase II

UniProt

Q8N5Z0

Expression Region

30-425aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-hnRNP U/p120/HNRNPU Antibody Picoband® Fluoro594 Conjugated
A03691-3-Fluoro594 100 µg/Vial

Anti-hnRNP U/p120/HNRNPU Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Famciclovir 10mM * 1mL in DMSO
A10380-10mM-D 10 mM x 1mL in DMSO

Famciclovir 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Attractin (ATRN) Polyclonal Antibody
CAU37015-01 100 µL

Attractin (ATRN) Polyclonal Antibody

Sign In for Pricing
View Details
Attractin (ATRN) Polyclonal Antibody
CAU37015-02 200 µL

Attractin (ATRN) Polyclonal Antibody

Sign In for Pricing
View Details
Attractin (ATRN) Polyclonal Antibody
CAU37015-03 1 mL

Attractin (ATRN) Polyclonal Antibody

Sign In for Pricing
View Details
Human PPIP5K1 knockout cell line
ABC-KH11976 1 Vial

Human PPIP5K1 knockout cell line

Sign In for Pricing
View Details