Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AADAT protein

This Human AADAT protein spans the amino acid sequence from region 30-425aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-aminoadipate aminotransferase2-aminoadipate transaminase (EC, 2.6.1.39) Alpha-aminoadipate aminotransferase , AadATKynurenine aminotransferase IIKynurenine--oxoglutarate aminotransferase IIKynurenine--oxoglutarate transaminase 2 (EC, 2.6.1.7) Kynurenine--oxoglutarate transaminase II

UniProt

Q8N5Z0

Expression Region

30-425aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tescl (NM_001163810) Mouse Untagged Clone
MC210888 10 µg

Tescl (NM_001163810) Mouse Untagged Clone

Sign In for Pricing
View Details
ATG5, CT (ATG5, APG5L, ASP, Autophagy protein 5, APG5-like, Apoptosis-specific protein)
MBS647983-01 0.2 mL

ATG5, CT (ATG5, APG5L, ASP, Autophagy protein 5, APG5-like, Apoptosis-specific protein)

Sign In for Pricing
View Details
ATG5, CT (ATG5, APG5L, ASP, Autophagy protein 5, APG5-like, Apoptosis-specific protein)
MBS647983-02 5x 0.2 mL

ATG5, CT (ATG5, APG5L, ASP, Autophagy protein 5, APG5-like, Apoptosis-specific protein)

Sign In for Pricing
View Details
MAb to Troponin I-Cardiac
MBS311139-01 1 mg

MAb to Troponin I-Cardiac

Sign In for Pricing
View Details
MAb to Troponin I-Cardiac
MBS311139-02 5x 1 mg

MAb to Troponin I-Cardiac

Sign In for Pricing
View Details
FOXR2 Protein Vector (Human) (pPM-C-His)
PV016640 500 ng

FOXR2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details