Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Abhd11 protein

This Mouse Abhd11 protein spans the amino acid sequence from region 1-307aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Williams-Beuren syndrome chromosomal region 21 protein homolog

UniProt

Q8K4F5

Expression Region

1-307aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin Rabbit Polyclonal Antibody (BF594)
orb1607137 100 µL

Desmin Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Human C-C motif chemokine 4 ELISA Kit
MBS2885853-01 48 Well

Human C-C motif chemokine 4 ELISA Kit

Sign In for Pricing
View Details
Human C-C motif chemokine 4 ELISA Kit
MBS2885853-02 96 Well

Human C-C motif chemokine 4 ELISA Kit

Sign In for Pricing
View Details
Human C-C motif chemokine 4 ELISA Kit
MBS2885853-03 5x 96 Well

Human C-C motif chemokine 4 ELISA Kit

Sign In for Pricing
View Details
Human C-C motif chemokine 4 ELISA Kit
MBS2885853-04 10x 96 Well

Human C-C motif chemokine 4 ELISA Kit

Sign In for Pricing
View Details
PEX3 Antibody
orb671440-01 50 µg

PEX3 Antibody

Sign In for Pricing
View Details