Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Abhd11 protein

This Mouse Abhd11 protein spans the amino acid sequence from region 1-307aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Williams-Beuren syndrome chromosomal region 21 protein homolog

UniProt

Q8K4F5

Expression Region

1-307aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4745-5p miRNA Mimic
CMH1611-01 5 nmol

Hsa-miR-4745-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-4745-5p miRNA Mimic
CMH1611-02 10 nmol

Hsa-miR-4745-5p miRNA Mimic

Sign In for Pricing
View Details
Ricinus Communis Agglutinin I (Fluorescein)
HY-NP0141 1 mg

Ricinus Communis Agglutinin I (Fluorescein)

Sign In for Pricing
View Details
PCYT1B 3'UTR GFP Stable Cell Line
TU067600 1.0 mL

PCYT1B 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ARPC1B Rabbit pAb, PerCP-Cy7 conjugated
orb2857096 100 µL

ARPC1B Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Comb for 25 samples, 0.75 mm thick
CGMD25-0.75 1 Unit

Comb for 25 samples, 0.75 mm thick

Sign In for Pricing
View Details