Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial inlA protein

This Bacterial inlA protein spans the amino acid sequence from region 562-770aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

InlA, LMOf2365_0471, Internalin A

UniProt

Q723K6

Expression Region

562-770aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Listeria monocytogenes serotype 4b (strain F2365)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LLGL2 Antibody
orb255630 100 µL

LLGL2 Antibody

Sign In for Pricing
View Details
Lentiviral human PTPRT shRNA (UAS) - Lentiviral human PTPRT shRNA (UAS, RFP) (100)
GTR15331275 1 Vial

Lentiviral human PTPRT shRNA (UAS) - Lentiviral human PTPRT shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
MZT1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2474412 100 µL

MZT1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
GORASP2 Knockout A549 Polyclonal Cells
ARG33579 1 Million

GORASP2 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Human Protein S100-A10 (S100A10) ELISA Kit
CK-bio-13105-01 48 Tests

Human Protein S100-A10 (S100A10) ELISA Kit

Sign In for Pricing
View Details
Human Protein S100-A10 (S100A10) ELISA Kit
CK-bio-13105-02 96 Tests

Human Protein S100-A10 (S100A10) ELISA Kit

Sign In for Pricing
View Details