Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial inlA protein

This Bacterial inlA protein spans the amino acid sequence from region 562-770aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

InlA, LMOf2365_0471, Internalin A

UniProt

Q723K6

Expression Region

562-770aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Listeria monocytogenes serotype 4b (strain F2365)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pack of 100 Technical Filter Discs 150G/M², 40 Mm
FT103A0040C Pack of 100

Pack of 100 Technical Filter Discs 150G/M², 40 Mm

Sign In for Pricing
View Details
Anti-Eftud2 Antibody (9L848)
TMAC-01237-01 50 μL

Anti-Eftud2 Antibody (9L848)

Sign In for Pricing
View Details
Anti-Eftud2 Antibody (9L848)
TMAC-01237-02 100 µL

Anti-Eftud2 Antibody (9L848)

Sign In for Pricing
View Details
FGA (Fibrinogen Alpha chain) BioAssayTM ELISA Kit (Mouse) discontinued
355638-01 48 Tests

FGA (Fibrinogen Alpha chain) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
FGA (Fibrinogen Alpha chain) BioAssayTM ELISA Kit (Mouse) discontinued
355638-02 96 Tests

FGA (Fibrinogen Alpha chain) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
PNOC Rabbit Polyclonal Antibody (APC)
orb3103321 100 µg

PNOC Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details