Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat ATG8 protein

This Rat ATG8 protein spans the amino acid sequence from region 1-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autophagy-related ubiquitin-like modifier ATG8 (AUT7)

UniProt

Q6FXR8

Expression Region

1-116aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS801636 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705417 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody
TA392675 100 µL

Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OVOL2 Rabbit Polyclonal Antibody
TA370350 100 µL

OVOL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Trifluoroacetylpropargylamine
TRC-T789630-500MG 500 mg

N-Trifluoroacetylpropargylamine

Sign In for Pricing
View Details
Nickel Sulfate Hexahydrate
TRC-N901063-500MG 500 mg

Nickel Sulfate Hexahydrate

Sign In for Pricing
View Details