Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ESRG protein

This Human ESRG protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ESRG, HESRG, Embryonic stem cell-related gene protein, hES cell-related gene protein

UniProt

Q1W209

Expression Region

1-222aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSVRKIHLRPQVLRPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNFNSFHSLVETKETCFIREPKTPAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPLAASPAFLGQGQVPLNPFSFTLSGKSRFSGAGASTPQPLLLHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound T128503
orb3170969-01 1 mg

Compound T128503

Sign In for Pricing
View Details
Compound T128503
orb3170969-02 2 mg

Compound T128503

Sign In for Pricing
View Details
Compound T128503
orb3170969-03 3 mg

Compound T128503

Sign In for Pricing
View Details
Compound T128503
orb3170969-04 4 mg

Compound T128503

Sign In for Pricing
View Details
Compound T128503
orb3170969-05 5 mg

Compound T128503

Sign In for Pricing
View Details
Recombinant Mouse Krueppel-like factor 6 (Klf6)
MBS1245577-01 0.02 mg (E-Coli)

Recombinant Mouse Krueppel-like factor 6 (Klf6)

Sign In for Pricing
View Details