Fungi RPN13 protein
This Fungi RPN13 protein spans the amino acid sequence from region 2-156aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Proteasome non-ATPase subunit 13
UniProt
O13563
Expression Region
2-156aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
33.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine5 Anti-Human CD58 Antibody[TS2/9.1]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d41e4/imageurl/e-ab-f1068g.webp)
E-AB-F1068G-01 20 Tests
PE/Cyanine5 Anti-Human CD58 Antibody[TS2/9.1]
Sign In for Pricing
View Details E-AB-F1068G-02 100 Tests
PE/Cyanine5 Anti-Human CD58 Antibody[TS2/9.1]
Sign In for Pricing
View Details E-AB-F1068G-03 2x 100 Tests
PE/Cyanine5 Anti-Human CD58 Antibody[TS2/9.1]
Sign In for Pricing
View Details ![ABL1 Recombinant Rabbit Monoclonal Antibody [PSH04-08]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81e45/imageurl/ha722089.webp)
HA722089 100 µL
ABL1 Recombinant Rabbit Monoclonal Antibody [PSH04-08]
Sign In for Pricing
View Details 
PKSV030343 100 µg
Recombinant SARS-CoV-2 N Protein (I292T) (His Tag)
Sign In for Pricing
View Details 