Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi RPN13 protein

This Fungi RPN13 protein spans the amino acid sequence from region 2-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proteasome non-ATPase subunit 13

UniProt

O13563

Expression Region

2-156aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Single Frequency type Ultrasonic Cleaner BULC-728
BULC-728 Each

Single Frequency type Ultrasonic Cleaner BULC-728

Sign In for Pricing
View Details
C1orf226 Antibody
KC-43288-01 50 μL

C1orf226 Antibody

Sign In for Pricing
View Details
C1orf226 Antibody
KC-43288-02 100 µL

C1orf226 Antibody

Sign In for Pricing
View Details
C1orf226 Antibody
KC-43288-03 1 mL

C1orf226 Antibody

Sign In for Pricing
View Details
ILF3 Human Gene Knockout Kit (CRISPR)
KN414999 1 Kit

ILF3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Saliva DNA Isolation 96-Well Kit
RU35200 192 Preparations

Saliva DNA Isolation 96-Well Kit

Sign In for Pricing
View Details