Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant PR10A protein

This Plant PR10A protein spans the amino acid sequence from region 20-196aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pathogenesis related protein 10A , CjPR10A

UniProt

A2A1A1

Expression Region

20-196aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Coptis japonica (Japanese goldthread)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERLIFNGRPLLHRVTKEETVMLYHELEVAASADEVWSVEGSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPPGQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYMDTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVPLAIMSEAIAKVVLENKHKSSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp50 Mouse Gene Knockout Kit (CRISPR)
KN518809 1 Kit

Usp50 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sulphanilamide
TRC-S689100-50MG 50 mg

Sulphanilamide

Sign In for Pricing
View Details
MARVELD2 (C-term) Rabbit Polyclonal Antibody
AP52590PU-N 400 µL

MARVELD2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF740 conjugate, 0.1mg/mL
BNC742301-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diisobutyl Adipate
TRC-D455203-50ML 50 mL

Diisobutyl Adipate

Sign In for Pricing
View Details
HSDL2 (NM_001195822) Human Over-expression Lysate
LC433809 20 µg

HSDL2 (NM_001195822) Human Over-expression Lysate

Sign In for Pricing
View Details