Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ruvC protein

This E. coli ruvC protein spans the amino acid sequence from region 2-173aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Holliday junction nuclease RuvCHolliday junction resolvase RuvC

UniProt

P0A814

Expression Region

2-173aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif1ax (NM_001106963) Rat Tagged ORF Clone Lentiviral Particle
RR211986L4V 200 µL

Eif1ax (NM_001106963) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Granzyme H (GZMH) (20-246, His-tag) Human Protein
AR51860PU-N 100 µg

Granzyme H (GZMH) (20-246, His-tag) Human Protein

Sign In for Pricing
View Details
Connexin-26 (GJB2, Gap Junction beta-2 Protein, Cx26) (MaxLight 405) discontinued
125218-ML405 100 µL

Connexin-26 (GJB2, Gap Junction beta-2 Protein, Cx26) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Meox1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4878302 1.0 µg DNA

Meox1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Splicing Factor 3B Subunit 3 (SF3B3) ELISA Kit
orb781833-01 48 Tests

Mouse Splicing Factor 3B Subunit 3 (SF3B3) ELISA Kit

Sign In for Pricing
View Details
Mouse Splicing Factor 3B Subunit 3 (SF3B3) ELISA Kit
orb781833-02 96 Tests

Mouse Splicing Factor 3B Subunit 3 (SF3B3) ELISA Kit

Sign In for Pricing
View Details