Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ruvC protein

This E. coli ruvC protein spans the amino acid sequence from region 2-173aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Holliday junction nuclease RuvCHolliday junction resolvase RuvC

UniProt

P0A814

Expression Region

2-173aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR1 (NM_023110) Human Mutant ORF Clone
RC403432 10 µg

FGFR1 (NM_023110) Human Mutant ORF Clone

Sign In for Pricing
View Details
Syndecan-1 (DL-101) Alexa Fluor® 594
sc-12765 AF594 200 µg/mL

Syndecan-1 (DL-101) Alexa Fluor® 594

Sign In for Pricing
View Details
Recombinant Olea europaea Profilin-3 (PRO3)
MBS1139631-01 0.02 mg (E-Coli)

Recombinant Olea europaea Profilin-3 (PRO3)

Sign In for Pricing
View Details
Recombinant Olea europaea Profilin-3 (PRO3)
MBS1139631-02 0.1 mg (E-Coli)

Recombinant Olea europaea Profilin-3 (PRO3)

Sign In for Pricing
View Details
Recombinant Olea europaea Profilin-3 (PRO3)
MBS1139631-03 0.02 mg (Yeast)

Recombinant Olea europaea Profilin-3 (PRO3)

Sign In for Pricing
View Details
Recombinant Olea europaea Profilin-3 (PRO3)
MBS1139631-04 0.1 mg (Yeast)

Recombinant Olea europaea Profilin-3 (PRO3)

Sign In for Pricing
View Details