Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ompC protein

This E. coli ompC protein spans the amino acid sequence from region 22-367aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer membrane protein 1BPorin OmpC

UniProt

P06996

Expression Region

22-367aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRDMT1 Protein (N-His, Human)
P509243 100 µg

TRDMT1 Protein (N-His, Human)

Sign In for Pricing
View Details
O-Nitrophenyl 2-Acetamido-2-deoxy-3,4,6-tri-O-acetyl-ß-D-galactopyranoside
N2594-02A 25 mg

O-Nitrophenyl 2-Acetamido-2-deoxy-3,4,6-tri-O-acetyl-ß-D-galactopyranoside

Sign In for Pricing
View Details
TRA2A Rabbit Polyclonal Antibody (PE)
orb493034 100 µL

TRA2A Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
RANBP1 Rabbit Polyclonal Antibody (Fluoro488)
orb3106638 100 µg

RANBP1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
NFKB2
553114 100 µg

NFKB2

Sign In for Pricing
View Details
Pellino 1 Polyclonal Antibody
MBS9234475-01 0.1 mL

Pellino 1 Polyclonal Antibody

Sign In for Pricing
View Details