Insect Css4 protein
This Insect Css4 protein spans the amino acid sequence from region 20-85aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Beta-mammal toxin Css4, Css IV, CssIV
UniProt
P60266
Expression Region
20-85aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Centruroides suffusus suffusus (Mexican scorpion)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
23.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-MSEL-M0117-01 24 Tests
Mini Sample Mouse TRACP-5b (Tartrate Resistant Acid Phosphatase 5) ELISA Kit
Sign In for Pricing
View Details E-MSEL-M0117-02 48 Tests
Mini Sample Mouse TRACP-5b (Tartrate Resistant Acid Phosphatase 5) ELISA Kit
Sign In for Pricing
View Details E-MSEL-M0117-03 96 Tests
Mini Sample Mouse TRACP-5b (Tartrate Resistant Acid Phosphatase 5) ELISA Kit
Sign In for Pricing
View Details 
BNC472746-500 1x 500 µL
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 