Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human U27 protein

This Human U27 protein spans the amino acid sequence from region 1-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphoprotein P41 , PP41, Polymerase accessory protein , PAP

UniProt

P52439

Expression Region

1-393aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRC1 (NM_145038) Human Over-expression Lysate
LH14168V 100 µg

DRC1 (NM_145038) Human Over-expression Lysate

Sign In for Pricing
View Details
Caspase-6 subunit p11 Rabbit Polyclonal Antibody (PerCP)
orb2444409 100 µL

Caspase-6 subunit p11 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
CEBPZ Polyclonal Antibody
E-AB-91544-01 60 µL

CEBPZ Polyclonal Antibody

Sign In for Pricing
View Details
CEBPZ Polyclonal Antibody
E-AB-91544-02 120 µL

CEBPZ Polyclonal Antibody

Sign In for Pricing
View Details
CEBPZ Polyclonal Antibody
E-AB-91544-03 200 µL

CEBPZ Polyclonal Antibody

Sign In for Pricing
View Details
Lurasidone 100mg
A11214-100 100 mg

Lurasidone 100mg

Sign In for Pricing
View Details