Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish mt protein

This Zebrafish mt protein spans the amino acid sequence from region 1-60aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mt, mt1, Metallothionein-1, MT-1

UniProt

P52722

Expression Region

1-60aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CIB1 Antibody Picoband® Fluoro488 Conjugated
PB9489-Fluoro488 100 µg/Vial

Anti-CIB1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
MSRA Rabbit Polyclonal Antibody (FITC)
orb2985415 100 µg

MSRA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human PRR21 Pre-designed siRNA Set A
SI012915A 1 Each

Human PRR21 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human LGALS9 shRNA (UAS) - Lentiviral human LGALS9 shRNA (UAS, GFP) (100)
GTR15091185 1 Vial

Lentiviral human LGALS9 shRNA (UAS) - Lentiviral human LGALS9 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Sestrin homolog (sesn-1)
MBS1457680-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Sestrin homolog (sesn-1)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Sestrin homolog (sesn-1)
MBS1457680-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Sestrin homolog (sesn-1)

Sign In for Pricing
View Details