Zebrafish mt protein
This Zebrafish mt protein spans the amino acid sequence from region 1-60aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mt, mt1, Metallothionein-1, MT-1
UniProt
P52722
Expression Region
1-60aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Danio rerio (Zebrafish) (Brachydanio rerio)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6322579-01 0.1 mL
MST1, CT (MST1, D3F15S2, DNF15S2, HGFL, Hepatocyte growth factor-like protein, Macrophage stimulatory protein, Macrophage-stimulating protein, Hepatocyte growth factor-like protein alpha chain, Hepatocyte growth factor-like protein beta chain) (MaxLight 6
Sign In for Pricing
View Details MBS6322579-02 5x 0.1 mL
MST1, CT (MST1, D3F15S2, DNF15S2, HGFL, Hepatocyte growth factor-like protein, Macrophage stimulatory protein, Macrophage-stimulating protein, Hepatocyte growth factor-like protein alpha chain, Hepatocyte growth factor-like protein beta chain) (MaxLight 6
Sign In for Pricing
View Details MBS280615-01 48 Tests
Rabbit Adenylate cyclase type 5 (ADCY5) ELISA Kit
Sign In for Pricing
View Details MBS280615-02 96 Tests
Rabbit Adenylate cyclase type 5 (ADCY5) ELISA Kit
Sign In for Pricing
View Details MBS280615-03 5x 96 Tests
Rabbit Adenylate cyclase type 5 (ADCY5) ELISA Kit
Sign In for Pricing
View Details MBS280615-04 10x 96 Tests
Rabbit Adenylate cyclase type 5 (ADCY5) ELISA Kit
Sign In for Pricing
View Details