Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human E7 protein

This Human E7 protein spans the amino acid sequence from region 1-99aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E7Protein E7

UniProt

P36831

Expression Region

1-99aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Human papillomavirus type 52

Field of Research

Cancer, Developmental Biology, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnfrsf10b (NM_020275) Mouse Untagged Clone
MC207426 10 µg

Tnfrsf10b (NM_020275) Mouse Untagged Clone

Sign In for Pricing
View Details
STO-609
BML-EI389-0005 5 mg

STO-609

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri SEQA Polyclonal Antibody
MBS7166455 Inquire

Rabbit anti-Shigella flexneri SEQA Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Cas scaffolding protein family member 4, Cass4 ELISA KIT
ELI-34470m 96 Tests

Mouse Cas scaffolding protein family member 4, Cass4 ELISA KIT

Sign In for Pricing
View Details
Human DNA polymerase lambda (POLL) ELISA Kit
MBS2803557-01 48 Tests

Human DNA polymerase lambda (POLL) ELISA Kit

Sign In for Pricing
View Details
Human DNA polymerase lambda (POLL) ELISA Kit
MBS2803557-02 96 Tests

Human DNA polymerase lambda (POLL) ELISA Kit

Sign In for Pricing
View Details