Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi GSP1 protein

This Fungi GSP1 protein spans the amino acid sequence from region 2-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chromosome stability protein 17GTPase Ran homologGenetic suppressor of PRP20-1

UniProt

P32835

Expression Region

2-219aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM8 (N-term) Rabbit Polyclonal Antibody
AP54365PU-N 400 µL

TRPM8 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bulk Anti-Human Hepsin (3H10.1) Antibody
ICH1161-5mg 5 mg

Bulk Anti-Human Hepsin (3H10.1) Antibody

Sign In for Pricing
View Details
Ngb (NM_022414) Mouse Tagged ORF Clone
MG201076 10 µg

Ngb (NM_022414) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GSTCD (NM_001031720) Human Over-expression Lysate
LY422170 100 µg

GSTCD (NM_001031720) Human Over-expression Lysate

Sign In for Pricing
View Details
Arginase 1 Polyclonal Antibody
E-AB-40587-01 25 µL

Arginase 1 Polyclonal Antibody

Sign In for Pricing
View Details
Arginase 1 Polyclonal Antibody
E-AB-40587-02 100 µL

Arginase 1 Polyclonal Antibody

Sign In for Pricing
View Details