Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila UbcD6 protein

This Drosophila UbcD6 protein spans the amino acid sequence from region 1-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin carrier proteinUbiquitin-protein ligase

UniProt

P25153

Expression Region

1-151aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Cancer, DNA Damage

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-151aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BSG Polyclonal Antibody
E-AB-40298-01 25 µL

BSG Polyclonal Antibody

Sign In for Pricing
View Details
BSG Polyclonal Antibody
E-AB-40298-02 100 µL

BSG Polyclonal Antibody

Sign In for Pricing
View Details
MUSK pTyr755 Rabbit Polyclonal Antibody
AP26453PU-S 50 µL

MUSK pTyr755 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2',3'-O-Isopropylidene-6-thioinosine
TRC-I825480-1G 1 g

2',3'-O-Isopropylidene-6-thioinosine

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501029 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
PLC delta 3 (PLCD3) (N-term) Rabbit Polyclonal Antibody
AP53337PU-N 400 µL

PLC delta 3 (PLCD3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details