Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi AAP1 protein

This Fungi AAP1 protein spans the amino acid sequence from region 1-389aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AAP1, YHR047CAlanine/arginine aminopeptidase, EC 3.4.11.-

UniProt

P37898

Expression Region

1-389aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 1-389aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O2T27 Polyclonal Antibody
JOT-AP12118-01 20 µL

O2T27 Polyclonal Antibody

Sign In for Pricing
View Details
O2T27 Polyclonal Antibody
JOT-AP12118-02 50 μL

O2T27 Polyclonal Antibody

Sign In for Pricing
View Details
O2T27 Polyclonal Antibody
JOT-AP12118-03 100 µL

O2T27 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human PBLD Protein, N-His
HA616012-01 50 µg

Recombinant Human PBLD Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PBLD Protein, N-His
HA616012-02 100 µg

Recombinant Human PBLD Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PBLD Protein, N-His
HA616012-03 1 mg

Recombinant Human PBLD Protein, N-His

Sign In for Pricing
View Details