Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi AAP1 protein

This Fungi AAP1 protein spans the amino acid sequence from region 1-389aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AAP1, YHR047CAlanine/arginine aminopeptidase, EC 3.4.11.-

UniProt

P37898

Expression Region

1-389aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 1-389aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP5 Mouse Monoclonal Antibody
AG1904 50 µL

FABP5 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Nalp10 / Nlrp10 (mouse) Immunizing Peptide
orb737666 100 µg

Nalp10 / Nlrp10 (mouse) Immunizing Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal PDLIM1 Antibody [PE]
NBP2-98546PE 0.1 mL

Rabbit Polyclonal PDLIM1 Antibody [PE]

Sign In for Pricing
View Details
KCNK1 siRNA (Rat)
MBS8221806-01 15 nmol

KCNK1 siRNA (Rat)

Sign In for Pricing
View Details
KCNK1 siRNA (Rat)
MBS8221806-02 30 nmol

KCNK1 siRNA (Rat)

Sign In for Pricing
View Details
KCNK1 siRNA (Rat)
MBS8221806-03 5x 30 nmol

KCNK1 siRNA (Rat)

Sign In for Pricing
View Details