Viral KP6 killer toxin protein
This Viral KP6 killer toxin protein spans the amino acid sequence from region 28-105aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
KP6 killer toxin, Killer protein 6) [Cleaved into, KP6 killer toxin subunit alpha, VP10), KP6 killer toxin subunit beta, VP12.5) ]
UniProt
P16948
Expression Region
28-105aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Ustilago maydis P6 virus (UmV6) (UmV-P6)
Field of Research
Infectious Disease & Virology; Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
24.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of KP6 killer toxin subunit alpha of His-SUMO-tag and expression region is 28-105aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681474-500 1x 500 µL
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2249-100 1x 100 µL
Transthyretin (Prealbumin) (CPTC-TTR-1), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 