Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral KP6 killer toxin protein

This Viral KP6 killer toxin protein spans the amino acid sequence from region 28-105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KP6 killer toxin, Killer protein 6) [Cleaved into, KP6 killer toxin subunit alpha, VP10), KP6 killer toxin subunit beta, VP12.5) ]

UniProt

P16948

Expression Region

28-105aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Ustilago maydis P6 virus (UmV6) (UmV-P6)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of KP6 killer toxin subunit alpha of His-SUMO-tag and expression region is 28-105aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 Antibody
KC-11763-01 50 μL

CD81 Antibody

Sign In for Pricing
View Details
CD81 Antibody
KC-11763-02 100 µL

CD81 Antibody

Sign In for Pricing
View Details
CD81 Antibody
KC-11763-03 1 mL

CD81 Antibody

Sign In for Pricing
View Details
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), Biotin conjugate, 0.1mg/mL
BNCB0900-500 1x 500 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2673), CF405S conjugate, 0.1mg/mL
BNC042673-100 1x 100 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2673), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C2cd3 Mouse Gene Knockout Kit (CRISPR)
KN502367 1 Kit

C2cd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details