Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral NP protein

This Viral NP protein spans the amino acid sequence from region 488-739aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein , Protein N

UniProt

P18272

Expression Region

488-739aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 488-739aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPN2 (18C19) Mouse Monoclonal Antibody
E28PB4086 100 µL

CAPN2 (18C19) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
IL22 antibody
70R-6002 100 µL

IL22 antibody

Sign In for Pricing
View Details
Human Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 (ACAP1) ELISA Kit
AE23326HU-01 48 Tests

Human Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 (ACAP1) ELISA Kit

Sign In for Pricing
View Details
Human Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 (ACAP1) ELISA Kit
AE23326HU-02 96 Tests

Human Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 (ACAP1) ELISA Kit

Sign In for Pricing
View Details
Bovine Intercellular Adhesion Molecule 3 (ICAM3) ELISA Kit-Sandwich
EK10F302-01 48 Test

Bovine Intercellular Adhesion Molecule 3 (ICAM3) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Intercellular Adhesion Molecule 3 (ICAM3) ELISA Kit-Sandwich
EK10F302-02 96 Tests

Bovine Intercellular Adhesion Molecule 3 (ICAM3) ELISA Kit-Sandwich

Sign In for Pricing
View Details