Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral NP protein

This Viral NP protein spans the amino acid sequence from region 488-739aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein , Protein N

UniProt

P18272

Expression Region

488-739aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 488-739aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sentrin-Specific Protease 7 Recombinant Protein N-6 His Tag
MBS8433479-01 0.05 mg

Human Sentrin-Specific Protease 7 Recombinant Protein N-6 His Tag

Sign In for Pricing
View Details
Human Sentrin-Specific Protease 7 Recombinant Protein N-6 His Tag
MBS8433479-02 5x 0.05 mg

Human Sentrin-Specific Protease 7 Recombinant Protein N-6 His Tag

Sign In for Pricing
View Details
Anti-Hu CD32 FITC Mab (3D3)
30-2914-100 100 Tests

Anti-Hu CD32 FITC Mab (3D3)

Sign In for Pricing
View Details
CRANAD-28 25mg
A22102-25 25 mg

CRANAD-28 25mg

Sign In for Pricing
View Details
Biotin Linked Polyclonal Antibody to Myosin Binding Protein C, Cardiac (MYBPC3)
MBS2135675-01 0.1 mL

Biotin Linked Polyclonal Antibody to Myosin Binding Protein C, Cardiac (MYBPC3)

Sign In for Pricing
View Details
Biotin Linked Polyclonal Antibody to Myosin Binding Protein C, Cardiac (MYBPC3)
MBS2135675-02 0.2 mL

Biotin Linked Polyclonal Antibody to Myosin Binding Protein C, Cardiac (MYBPC3)

Sign In for Pricing
View Details