Human BFRF3 protein
This Human BFRF3 protein spans the amino acid sequence from region 31-176aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
SCP, BFRF3, Small capsomere-interacting protein
UniProt
P14348
Expression Region
31-176aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Field of Research
Non-Animal
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
30.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial of His-SUMO-tag and expression region is 31-176aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2615049-01 48 Well
Goat receptor TNFRSF-interacting serine-threonine kinase 2 (RIPK2) ELISA Kit
Sign In for Pricing
View Details MBS2615049-02 96 Well
Goat receptor TNFRSF-interacting serine-threonine kinase 2 (RIPK2) ELISA Kit
Sign In for Pricing
View Details MBS2615049-03 5x 96 Well
Goat receptor TNFRSF-interacting serine-threonine kinase 2 (RIPK2) ELISA Kit
Sign In for Pricing
View Details MBS2615049-04 10x 96 Well
Goat receptor TNFRSF-interacting serine-threonine kinase 2 (RIPK2) ELISA Kit
Sign In for Pricing
View Details 
MBS6362970-01 0.1 mL
WAC, ID (WAC, KIAA1844, WW domain-containing adapter protein with coiled-coil) (MaxLight 750)
Sign In for Pricing
View Details