Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BFRF3 protein

This Human BFRF3 protein spans the amino acid sequence from region 31-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SCP, BFRF3, Small capsomere-interacting protein

UniProt

P14348

Expression Region

31-176aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 31-176aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RB1 antibody
70R-19793 50 μL

RB1 antibody

Sign In for Pricing
View Details
Lentiviral mouse Neil1 shRNA (UAS) - Lentiviral mouse Neil1 shRNA (UAS) (100)
GTR15149226 1 Vial

Lentiviral mouse Neil1 shRNA (UAS) - Lentiviral mouse Neil1 shRNA (UAS) (100)

Sign In for Pricing
View Details
5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine 99+% (HPLC)
233937-01 100 mg

5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine 99+% (HPLC)

Sign In for Pricing
View Details
5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine 99+% (HPLC)
233937-02 250 mg

5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine 99+% (HPLC)

Sign In for Pricing
View Details
5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine 99+% (HPLC)
233937-03 1 g

5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine 99+% (HPLC)

Sign In for Pricing
View Details
5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine 99+% (HPLC)
233937-04 5 g

5-Bromo-1H-pyrazolo[3,4-b]pyridin-3-ylamine 99+% (HPLC)

Sign In for Pricing
View Details