Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral vpx protein

This Viral vpx protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Viral protein XX ORF protein

UniProt

P11266

Expression Region

1-112aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Simian immunodeficiency virus (isolate K78) (SIV-mac) (Simian immunodeficiency virus rhesus monkey)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-112aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDPRERIPPRNSGEETIGEAFEWLNRTVEEINREAVNHLPRELIFQVWQRSWEYWHDEQRMSQSYVKYRYLCLMQKALFMHCKKGCRCLGEGHRAGGWRPGPPPPPPPGLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRTX1257
207086 5.0mg

MRTX1257

Sign In for Pricing
View Details
Stap1 (NM_019992) Mouse Untagged Clone
MC210097 10 µg

Stap1 (NM_019992) Mouse Untagged Clone

Sign In for Pricing
View Details
CALML4 Protein Vector (Mouse) (pPM-C-HA)
14944025 500 ng

CALML4 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Hsa-miR-1273h-3p miRNA Antagomir
orb1913800-01 10 nmol

Hsa-miR-1273h-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-1273h-3p miRNA Antagomir
orb1913800-02 20 nmol

Hsa-miR-1273h-3p miRNA Antagomir

Sign In for Pricing
View Details
1- (3-bromo-2-fluorophenyl) propan-1-one
PC1009953 1 Each

1- (3-bromo-2-fluorophenyl) propan-1-one

Sign In for Pricing
View Details