Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral vpx protein

This Viral vpx protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Viral protein XX ORF protein

UniProt

P11266

Expression Region

1-112aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Simian immunodeficiency virus (isolate K78) (SIV-mac) (Simian immunodeficiency virus rhesus monkey)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-112aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDPRERIPPRNSGEETIGEAFEWLNRTVEEINREAVNHLPRELIFQVWQRSWEYWHDEQRMSQSYVKYRYLCLMQKALFMHCKKGCRCLGEGHRAGGWRPGPPPPPPPGLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOBTB2 (DBC2, KIAA0717, Rho-related BTB Domain-containing Protein 2, Deleted in Breast Cancer 2 Gene Protein, p83) (MaxLight 405) discontinued
132556-ML405 100 µL

RHOBTB2 (DBC2, KIAA0717, Rho-related BTB Domain-containing Protein 2, Deleted in Breast Cancer 2 Gene Protein, p83) (MaxLight 405) discontinued

Sign In for Pricing
View Details
4-Bromo-2,3-difluorobenzoic acid
PC9173-01 1 g

4-Bromo-2,3-difluorobenzoic acid

Sign In for Pricing
View Details
4-Bromo-2,3-difluorobenzoic acid
PC9173-02 5 g

4-Bromo-2,3-difluorobenzoic acid

Sign In for Pricing
View Details
4-Bromo-2,3-difluorobenzoic acid
PC9173-03 10 g

4-Bromo-2,3-difluorobenzoic acid

Sign In for Pricing
View Details
ACHE Antibody - N-terminal region : HRP (ARP56761_P050-HRP)
ARP56761_P050-HRP 100 µL

ACHE Antibody - N-terminal region : HRP (ARP56761_P050-HRP)

Sign In for Pricing
View Details
KleC Antibody
orb819732 2 mg

KleC Antibody

Sign In for Pricing
View Details