Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral vpx protein

This Viral vpx protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Viral protein XX ORF protein

UniProt

P11266

Expression Region

1-112aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Simian immunodeficiency virus (isolate K78) (SIV-mac) (Simian immunodeficiency virus rhesus monkey)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-112aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDPRERIPPRNSGEETIGEAFEWLNRTVEEINREAVNHLPRELIFQVWQRSWEYWHDEQRMSQSYVKYRYLCLMQKALFMHCKKGCRCLGEGHRAGGWRPGPPPPPPPGLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TMEM109 Antibody [Alexa Fluor 594]
NBP3-18465AF594 0.1 mL

Rabbit Polyclonal TMEM109 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
HspQ Antibody
orb819156 2 mg

HspQ Antibody

Sign In for Pricing
View Details
T Plastin Antibody
DF13459-01 100 µL

T Plastin Antibody

Sign In for Pricing
View Details
T Plastin Antibody
DF13459-02 200 µL

T Plastin Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal West Nile Virus MP Antibody [Alexa Fluor 594]
NBP2-41053AF594 0.1 mL

Rabbit Polyclonal West Nile Virus MP Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
DGKI CRISPR All-in-one AAV vector set (with saCas9)(Rat)
18160156 3x 1.0 µg DNA

DGKI CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details