Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dac g 3 protein

This Rat Dac g 3 protein spans the amino acid sequence from region 1-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pollen allergen Dac g 3, Allergen Dac g III, allergen Dac g 3, Fragment

UniProt

P93124

Expression Region

1-96aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-96aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMP Human PDGF-BB Protein
GMP-PDBH19-500ug 500 µg

GMP Human PDGF-BB Protein

Sign In for Pricing
View Details
Tmco1 (NM_001039483) Mouse Tagged ORF Clone
MG201773 10 µg

Tmco1 (NM_001039483) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse IgM Antibody[RMM-1]

Sign In for Pricing
View Details
Protein Kinase A reguLatory subunit I alpha (PRKAR1A) (NM_212472) Human Recombinant Protein
TP312810L 1 mg

Protein Kinase A reguLatory subunit I alpha (PRKAR1A) (NM_212472) Human Recombinant Protein

Sign In for Pricing
View Details
CARD9 Polyclonal Antibody
E-AB-11032-01 20 µL

CARD9 Polyclonal Antibody

Sign In for Pricing
View Details