Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dac g 3 protein

This Rat Dac g 3 protein spans the amino acid sequence from region 1-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pollen allergen Dac g 3, Allergen Dac g III, allergen Dac g 3, Fragment

UniProt

P93124

Expression Region

1-96aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-96aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trihexyl Phosphate (>90%)
TRC-T794765-500MG 500 mg

Trihexyl Phosphate (>90%)

Sign In for Pricing
View Details
Mouse Vps11 activation kit by CRISPRa
GA208916 1 Kit

Mouse Vps11 activation kit by CRISPRa

Sign In for Pricing
View Details
FOXF1 Recombinant Rabbit Monoclonal Antibody [JE40-61]
HA722456 100 µL

FOXF1 Recombinant Rabbit Monoclonal Antibody [JE40-61]

Sign In for Pricing
View Details
Human RAB33B activation kit by CRISPRa
GA113176 1 Kit

Human RAB33B activation kit by CRISPRa

Sign In for Pricing
View Details
MCM6 (Proliferation Marker) (MCM6/2999), CF647 conjugate, 0.1mg/mL
BNC472999-100 1x 100 µL

MCM6 (Proliferation Marker) (MCM6/2999), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Troponin T1 (TNNT1) (NM_003283) Human Recombinant Protein
TP321318L 1 mg

Troponin T1 (TNNT1) (NM_003283) Human Recombinant Protein

Sign In for Pricing
View Details