Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dac g 3 protein

This Rat Dac g 3 protein spans the amino acid sequence from region 1-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pollen allergen Dac g 3, Allergen Dac g III, allergen Dac g 3, Fragment

UniProt

P93124

Expression Region

1-96aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-96aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lincomycin
TRC-L466230-500MG 500 mg

Lincomycin

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS804359 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
MOSMO Human Gene Knockout Kit (CRISPR)
KN428103 1 Kit

MOSMO Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ankrd34b Mouse Gene Knockout Kit (CRISPR)
KN501284 1 Kit

Ankrd34b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NKX2.2 (NX2/294), Biotin conjugate, 0.1mg/mL
BNCB0294-100 1x 100 µL

NKX2.2 (NX2/294), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR4F6 Antibody
8G600-AAT 50 µg

OR4F6 Antibody

Sign In for Pricing
View Details